PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_198.17
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family HB-other
Protein Properties Length: 403aa    MW: 44236.9 Da    PI: 6.0689
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_198.17genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.99.6e-2058113156
                                   TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                      Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                   +++ +++t+ q++e+e++F+++++p+ ++r+ L+++lgL+  qVk+WFqN+R+++k
  evm.model.supercontig_198.17  58 KKRYHRHTQRQIQEMEAFFKECPHPDDKQRKALSRELGLEPLQVKFWFQNKRTQMK 113
                                   688999***********************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.0E-2240113IPR009057Homeodomain-like
SuperFamilySSF466895.01E-1945116IPR009057Homeodomain-like
PROSITE profilePS5007116.3955115IPR001356Homeobox domain
SMARTSM003894.7E-1856119IPR001356Homeobox domain
CDDcd000862.43E-1858116No hitNo description
PfamPF000462.6E-1758113IPR001356Homeobox domain
PROSITE patternPS00027090113IPR017970Homeobox, conserved site
SuperFamilySSF559612.75E-19220398No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 403 aa     Download sequence    Send to blast
MFEPNMFESH HLFDMTPKTS DSELIGKIRD DDYETKSGTE TAEANSGDDQ DPNQRPKKKR  60
YHRHTQRQIQ EMEAFFKECP HPDDKQRKAL SRELGLEPLQ VKFWFQNKRT QMKAQNERHE  120
NAILKAENEK LRAENNRYKE ALSNASCPNC GGPAALGEMS FDEQHLRIEN VRLKEEIDRI  180
SGIAAKYVGK PMDSFSQFSS HTRSLDLGVS SFGAQSGGRP PGIVLSAATS FWIPVSPKRV  240
FEFLRNENSR SEWDILSNGG LVQEMAHIAN GREPGNCVSL LRVNSANSSQ SNMLILQESC  300
TDSTGSYVIY APVDIAAMNI VLSGGDPDYV ALLPSGFAIL PDGPAGLNAT GIMDVGSGGS  360
LLTVAFQILV DSIPTAKLSL GSVATVNSLI KCTIERIKTA VI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4778246e-42AM477824.1 Vitis vinifera contig VV78X054788.8, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012091395.11e-129PREDICTED: homeobox-leucine zipper protein MERISTEM L1
SwissprotQ93V991e-115PDF2_ARATH; Homeobox-leucine zipper protein PROTODERMAL FACTOR 2
TrEMBLM8AUY80.0M8AUY8_AEGTA; Homeobox-leucine zipper protein ROC7
STRINGPOPTR_0004s01980.11e-124(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49128149
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.11e-116protodermal factor 2